DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Camk1d

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001100835.1 Gene:Camk1d / 307124 RGDID:1560691 Length:385 Species:Rattus norvegicus


Alignment Length:339 Identity:111/339 - (32%)
Similarity:171/339 - (50%) Gaps:25/339 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKR-NVEREVEIMNSLQHHLII 92
            |..|.::....:|.|.|..|....:||.|...|.|.:|....:.|. ::|.|:.::..::|..|:
  Rat    18 DIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIV 82

  Fly    93 QLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLK 157
            .|...||....:.:|::|:.|||||||:|:..| .||:.....||||.:|:.::|..||||.|||
  Rat    83 ALEDIYESPNHLYLVMQLVSGGELFDRIVEKGF-YTEKDASTLIRQVLDAVYYLHRMGIVHRDLK 146

  Fly   158 PENILVLTQ-KGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVIC 221
            |||:|..:| :.::|.|.||||::.......:....|||.:|||||:.....|...|.||:|||.
  Rat   147 PENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIA 211

  Fly   222 YVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKH 286
            |:|:.|..||..|||.:....:..|:|:|:...::.||....|||..|:.||.:.|.|..:..:|
  Rat   212 YILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARH 276

  Fly   287 KWLQQRPATAATATPITKAASAA-----SKSRLKSVSPVTAPSE--------SSEDSTETIEDED 338
            .|:   ....|.:..|.::.||.     :||:.:.....||...        ||.||:......:
  Rat   277 PWI---AGDTALSKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRRLQLGSSLDSSNASVSSN 338

  Fly   339 DEEEVAVQQAKQKD 352
                  :..|.|||
  Rat   339 ------LSLASQKD 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 92/256 (36%)
STKc_MLCK 40..289 CDD:271005 92/250 (37%)
Camk1dNP_001100835.1 STKc_CaMKI_delta 12..312 CDD:271070 101/297 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.