DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and cmk1

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_593464.1 Gene:cmk1 / 2542442 PomBaseID:SPACUNK12.02c Length:335 Species:Schizosaccharomyces pombe


Alignment Length:273 Identity:101/273 - (36%)
Similarity:149/273 - (54%) Gaps:14/273 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRN-VEREVEIMN--SLQHHLIIQLY 95
            |.|...:|.|.:.||.:..........|||.:.....|.|:: |:.|:.|:.  |.:|..|:.|.
pombe    31 YRVGRVLGGGTYATVREAVHIETNKMYAAKIMNKKMMEKKQDFVKNEIAILKRVSYEHPNILHLV 95

  Fly    96 AAYEYQKMMCVVLELIEGGELFDRV-VDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPE 159
            ..:|....:.::.||..|||||||: ....|.  |......:|....|:.::|.|||||.|||||
pombe    96 DFFETVNNLYLITELATGGELFDRICAKGSFY--EADAAALMRTTTSAVKYLHDNGIVHRDLKPE 158

  Fly   160 NILVLTQKGNR-IKIIDFGLARKFDPDK--RLRVLFGTPEFVAPEVVNFDCISYG--TDMWSVGV 219
            |:|..::..|. :.|.||||:..::..:  .|....||||::||||  |....||  .|||::||
pombe   159 NLLYRSKDPNSDLLIADFGLSHFYEDSQYYMLMTACGTPEYMAPEV--FRRTGYGKPVDMWAIGV 221

  Fly   220 ICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECM 284
            |.|.|:||.:||...:.:|.:..:...:|.|.|.|::|||....|||.|.|..|.|.|:|||:.:
pombe   222 ITYFLLSGYTPFARPSQVEVIEAILANEYTFNDPCWSGISETAKDFIKKCLENDPSKRLTAADAL 286

  Fly   285 KHKWL-QQRPATA 296
            ||.:| ::||||:
pombe   287 KHPFLSEKRPATS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 96/263 (37%)
STKc_MLCK 40..289 CDD:271005 94/257 (37%)
cmk1NP_593464.1 STKc_CAMK 30..290 CDD:270687 96/262 (37%)
S_TKc 31..291 CDD:214567 96/263 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.