DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Uhmk1

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_058989.1 Gene:Uhmk1 / 246332 RGDID:2968 Length:419 Species:Rattus norvegicus


Alignment Length:416 Identity:101/416 - (24%)
Similarity:165/416 - (39%) Gaps:83/416 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YDVLGEVGRGKFGTVYK---CRDKANGLQLAAKFVP-----IPKREDKRNVEREVEIMNSLQ-HH 89
            :.|...:|.|...:||:   |....:......:|:|     ......:....:|...:..|| |.
  Rat    23 WQVQSRLGSGSSASVYRVRCCGTPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHR 87

  Fly    90 LIIQLYAAYEYQ-----KMMCVVLELIEGGELFDRVVDDEFVL-TERVCRVFI-----RQVCEAM 143
            .|:.||..:...     ...|::|||:      |..|.:..|. :.:.|.:::     |.|.||:
  Rat    88 NIVTLYGVFTIHFSPNVPSRCLLLELL------DVSVSELLVYSSHQGCSMWMIQHCARDVLEAL 146

  Fly   144 AFIHGNGIVHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCI 208
            ||:|..|.||.||||.||| .:.:....|:|||||:.| :.::.::.: .|..:.|||....:|:
  Rat   147 AFLHHEGYVHADLKPRNIL-WSAENECFKLIDFGLSFK-EGNQDVKYI-QTDGYRAPEAELQNCL 208

  Fly   209 SY-----------GTDMWSVGVICYVLISG--LSPFMGENDIETMSNVTIAKYDFEDECFNGISP 260
            :.           ..|:||:|:|...:.||  |...:...:.:..|:..|..........|...|
  Rat   209 AQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIP 273

  Fly   261 --ECLDFIAKLLAKDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAASKSRLKSV-SPVTA 322
              ...|.|..:|..|.|.|:              ||..|..:|......|.....|..: :||..
  Rat   274 AYHLRDLIKSMLHDDPSRRI--------------PAEMALCSPFFSIPFAPHIEDLVMLPTPVLR 324

  Fly   323 PSESSEDSTETIEDEDDEEEVAVQQAKQKDQ------------------QQDEELANLCGDAELE 369
            .....:|  :.:|:||:.|:| |:..|::.|                  |...|.|| .||::..
  Rat   325 LLNVLDD--DYLENEDEYEDV-VEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYAN-AGDSKAA 385

  Fly   370 NKELDATKDNLKNFIVRWETHPNSPY 395
            .|.|.....:.| |:|. ..:|.|.|
  Rat   386 QKLLTGRMFDGK-FVVA-TFYPLSAY 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 70/289 (24%)
STKc_MLCK 40..289 CDD:271005 69/283 (24%)
Uhmk1NP_058989.1 STKc_KIS 22..308 CDD:270922 74/307 (24%)
RRM_UHMK1 318..405 CDD:409898 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.