DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Pskh1

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_775608.1 Gene:Pskh1 / 244631 MGIID:3528383 Length:424 Species:Mus musculus


Alignment Length:338 Identity:110/338 - (32%)
Similarity:171/338 - (50%) Gaps:30/338 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRNVEREVEIMNSLQHHLIIQLYAAY 98
            ||:...:|||.|..|.:...:|.....|.|.:....||.:...|.|:.::..::|..||||...:
Mouse    98 YDIKALIGRGSFSRVVRVEHRATRQPYAIKMIETKYREGREVCESELRVLRRVRHANIIQLVEVF 162

  Fly    99 EYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILV 163
            |.|:.:.:|:||..|||||||:: .:...|||.....::.|.:.:.::|..||.|.||||||:|.
Mouse   163 ETQERVYMVMELATGGELFDRII-AKGSFTERDATRVLQMVLDGVRYLHALGITHRDLKPENLLY 226

  Fly   164 LTQKGNRIKII--DFGL--ARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYVL 224
            . ..|...|||  ||||  |||...|..::...||||::||||:.....:...|||::|||.|:|
Mouse   227 Y-HPGTDSKIIITDFGLASARKKGDDCLMKTTCGTPEYIAPEVLVRKPYTNSVDMWALGVIAYIL 290

  Fly   225 ISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKWL 289
            :||..||..:|.......:...||.:..|.:..:|....|||.:||..|...||||.:.::|.|:
Mouse   291 LSGTMPFEDDNRTRLYRQILRGKYSYLGEPWPSVSNLAKDFIDRLLTVDPGARMTALQALRHPWV 355

  Fly   290 QQRPATAATATPITKAASAASKSRLKSVS-----------PVTAPSESSEDSTETIEDEDDE-EE 342
                        ::.|||::.|:..:|:|           ..|..|:|:..|..|..::... .|
Mouse   356 ------------VSMAASSSMKNLHRSISQNLLKRASSRCQSTKSSQSTRSSRSTRSNKSRRVRE 408

  Fly   343 VAVQQAKQKDQQQ 355
            ..:::...:.|||
Mouse   409 RELRELNLRYQQQ 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 94/258 (36%)
STKc_MLCK 40..289 CDD:271005 92/252 (37%)
Pskh1NP_775608.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..79
STKc_PSKH1 96..355 CDD:270989 94/258 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..408 5/29 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.