DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Mylk4

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_006516731.1 Gene:Mylk4 / 238564 MGIID:3643758 Length:656 Species:Mus musculus


Alignment Length:293 Identity:143/293 - (48%)
Similarity:202/293 - (68%) Gaps:16/293 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IDDSEPEGVLEPAFPMRDVTINRNVDA-HKHYDVLGEV------GRGKFGTVYKCRDKANGLQLA 61
            :||     :..||.|..    :|.|.| |...|.|..|      |.|:||.|:||.:||.||:||
Mouse   348 LDD-----IPAPAAPFD----HRMVMAKHASVDNLYTVSKSEILGGGRFGQVHKCEEKATGLKLA 403

  Fly    62 AKFVPIPKREDKRNVEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFV 126
            ||.:.....:||.:|:.|:.:||.|.|..:||||.|:|.:..:.:|:|.:||||||||::|:...
Mouse   404 AKIIKTRGAKDKEDVKNEISVMNQLDHVNLIQLYDAFESKHDIILVMEYVEGGELFDRIIDENCN 468

  Fly   127 LTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLRVL 191
            |||....:|::|:||.:.::|...|:||||||||||.:.:...:||||||||||::.|.::|:|.
Mouse   469 LTELDTILFMKQICEGIRYMHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKLKVN 533

  Fly   192 FGTPEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFN 256
            ||||||:||||||:|.:|:.|||||||||.|:|:||||||:|:||.||::|:...::|.|||.|.
Mouse   534 FGTPEFLAPEVVNYDFVSFSTDMWSVGVITYMLLSGLSPFLGDNDAETLTNILACRWDLEDEEFQ 598

  Fly   257 GISPECLDFIAKLLAKDLSTRMTAAECMKHKWL 289
            .||.|..:||:|||.|:.|.|::|:|.:||.||
Mouse   599 DISEEAKEFISKLLIKEKSWRISASEALKHPWL 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 132/260 (51%)
STKc_MLCK 40..289 CDD:271005 130/254 (51%)
Mylk4XP_006516731.1 STKc_MLCK4 371..631 CDD:271095 132/259 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000818
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.