DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Y50D7A.3

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001368037.1 Gene:Y50D7A.3 / 190101 WormBaseID:WBGene00021753 Length:426 Species:Caenorhabditis elegans


Alignment Length:335 Identity:103/335 - (30%)
Similarity:167/335 - (49%) Gaps:51/335 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TINRNVDAHKHY---------------DVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPI----- 67
            |.:.:.|..:||               :||   |||...||.:|.:|.:|...|.|.|.|     
 Worm     8 TDHEDSDESQHYRHEEDQGFNAAYESKEVL---GRGLASTVRRCIEKGSGQHFAVKIVDISTEKQ 69

  Fly    68 PKREDKRNVER---EVEIMNSLQ-HHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLT 128
            .:.|.||.:|.   ||||:..|. |..||:::..|:....:..|.|:...||||| |::....::
 Worm    70 SENEAKRLLEETISEVEILRQLSGHPSIIKIHDFYQTPSFLFAVFEMAPRGELFD-VLNSTVTVS 133

  Fly   129 ERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLRVLFG 193
            |:..|..::|:.:.:.::|...|||.|||.||||.:.::  ||.|.|||.|.:....|:||.|.|
 Worm   134 EKRARRLMKQLFDGVEYMHARDIVHRDLKLENILCIDEE--RIVISDFGFATRIPRGKKLRDLCG 196

  Fly   194 TPEFVAPEVV------NFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFED 252
            ||.::|||.:      |.:..|...|.|::|||.|.|::|.:||.....:..:..:...|::|.:
 Worm   197 TPGYLAPETIRCQWYDNAEGYSLEVDEWALGVIMYTLLAGCAPFYHRKQLMMLRLIQQGKFEFRN 261

  Fly   253 ECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKWL-----QQRPATAATATPITKA------A 306
            |.:..|:.|..:.|.:||..|.:.|:::.||:.|:|:     ||.|    ...|:.:.      .
 Worm   262 EQWANITAEAKNLITQLLQVDATKRISSKECLAHEWMIPIAQQQAP----QMVPVVEVELVKDQT 322

  Fly   307 SAASKSRLKS 316
            |..::.|.|:
 Worm   323 SERARKRFKT 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 92/284 (32%)
STKc_MLCK 40..289 CDD:271005 89/263 (34%)
Y50D7A.3NP_001368037.1 STKc_PhKG 27..298 CDD:270995 91/276 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4277
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.