DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Phkg1

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_035209.1 Gene:Phkg1 / 18682 MGIID:97579 Length:388 Species:Mus musculus


Alignment Length:344 Identity:98/344 - (28%)
Similarity:154/344 - (44%) Gaps:45/344 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DDSEPEGVLEPAFPMRDVTINRNVDAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPI-- 67
            ||:.|:......|             :::|:....:|||....|.:|..|....:.|.|.:.|  
Mouse     4 DDALPDSHSAQTF-------------YENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITG 55

  Fly    68 -------PKREDKRNVEREVEIMNSLQ-HHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDE 124
                   ..:|.:....:||:|:..:. |..||||...||......:|.:|::.||||| .:.::
Mouse    56 GGSFSSEEVQELREATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFD-YLTEK 119

  Fly   125 FVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLR 189
            ..|||:..|..:|.:.|.:..:|...|||.||||||||:  .....||:.|||.:.:..|.::||
Mouse   120 VTLTEKETRKIMRALLEVICTLHKLNIVHRDLKPENILL--DDNMNIKLTDFGFSCQLQPGEKLR 182

  Fly   190 VLFGTPEFVAPEVVNFDCI------SYG--TDMWSVGVICYVLISGLSPFMGENDIETMSNVTIA 246
            .:.|||.::|||::  .|.      .||  .||||.|||.|.|::|..||.....:..:..:...
Mouse   183 EVCGTPSYLAPEII--QCSMDDGHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMDG 245

  Fly   247 KYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKWLQQ---------RPATAATATPI 302
            ||.|....::..|....|.:::.|......|.:|.|.:.|.:.|:         .|........:
Mouse   246 KYQFGSPEWDDYSDTVKDLVSRFLVVQPQDRCSAEEALAHPFFQEYVVEEVRHFSPRGKFKVICL 310

  Fly   303 TKAASAASKSRLKSVSPVT 321
            |..||.....:.:.|.|||
Mouse   311 TVLASVKIYYQYRRVKPVT 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 85/272 (31%)
STKc_MLCK 40..289 CDD:271005 84/266 (32%)
Phkg1NP_035209.1 PKc_like 16..291 CDD:328722 87/292 (30%)
Calmodulin-binding (domain-N) 303..327 4/23 (17%)
Calmodulin-binding (domain-C) 343..367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4277
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.