DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and zyg-8

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_499571.2 Gene:zyg-8 / 176639 WormBaseID:WBGene00006993 Length:802 Species:Caenorhabditis elegans


Alignment Length:264 Identity:78/264 - (29%)
Similarity:126/264 - (47%) Gaps:22/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VGRGKFGTVYKCRDKANGLQLAAKFVPIPKRED----KRNVEREVEIMNSLQHHLIIQLYAAYEY 100
            :|.|....||:..||.|...  .|.:.:..||:    :..:|.|:.|:..:.|..|:|||..:..
 Worm   488 IGDGNTAVVYEVIDKTNNDD--RKAMKVIARENVIGKEHLIEMELAILQKIDHTFIVQLYDHWFV 550

  Fly   101 QKMMCVVLELIEGGELFD-----RVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPEN 160
            .....:.|||||.|:||:     |.|.:...:....|      :.:|:.:||..||||.|:|.||
 Worm   551 DDSYYLSLELIEMGDLFEHLRIVRRVPERDAVRMMTC------LGQALEYIHELGIVHRDVKLEN 609

  Fly   161 ILVLTQKGNR--IKIIDFGLARKFDPD-KRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICY 222
            :|::..:...  :|:.|||||.:...| ..|..:.|||.:|||||:|........|:|:.|||.|
 Worm   610 LLIVKDEFGELGVKLADFGLAAEMPKDFGVLSTICGTPTYVAPEVLNKTGYGCKVDIWAAGVILY 674

  Fly   223 VLISGLSPFMGENDIE--TMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECMK 285
            .::.|..||...:..|  ..|.:...::.|....::.:|......|..|:..|...|.:|.|.:.
 Worm   675 AILVGFPPFQSSDGSEQDLFSAIMSGEFSFPSPSWDDVSWSVRHLIMCLIHTDPFHRYSAGELLN 739

  Fly   286 HKWL 289
            .:|:
 Worm   740 DEWM 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 77/262 (29%)
STKc_MLCK 40..289 CDD:271005 77/262 (29%)
zyg-8NP_499571.2 DCX 206..298 CDD:214711
DCX 335..423 CDD:214711
STKc_DCKL 481..742 CDD:270997 77/261 (30%)
S_TKc 482..743 CDD:214567 77/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.