DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Camk1g

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_878262.1 Gene:Camk1g / 171358 RGDID:621800 Length:476 Species:Rattus norvegicus


Alignment Length:426 Identity:119/426 - (27%)
Similarity:189/426 - (44%) Gaps:73/426 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RNVDAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRNVEREVEIMNSLQHHL 90
            :..:..|.:..:..:|.|.|..|:..:.:..|...|.|.:.........::|.|:.::..::|..
  Rat    15 QTTNIRKTFIFMEVLGSGAFSEVFLVKQRVTGKLFALKCIKKSPAFRDSSLENEIAVLKRIKHEN 79

  Fly    91 IIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLD 155
            |:.|...||......:|::|:.|||||||:: :..|.||:...:.|:||..|:.::|.|||||.|
  Rat    80 IVTLEDIYESTTHYYLVMQLVSGGELFDRIL-ERGVYTEKDASLVIQQVLSAVKYLHENGIVHRD 143

  Fly   156 LKPENILVLT-QKGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNFDCISYGTDMWSVGV 219
            |||||:|.|| ::.::|.|.||||: |.:.:..:....|||.:|||||:.....|...|.||:||
  Rat   144 LKPENLLYLTPEENSKIMITDFGLS-KMEQNGVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGV 207

  Fly   220 ICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLLAKDLSTRMTAAECM 284
            |.|:|:.|..||..|.:.:....:....|:||...::.||....|||..||.||.:.|.|..:.:
  Rat   208 ITYILLCGYPPFYEETESKLFEKIKEGYYEFESPFWDDISESAKDFICHLLEKDPNERYTCEKAL 272

  Fly   285 KHKWLQQRPATAATATPITKAASAASKSRLKSVSPVTAPSESSEDSTETIEDEDDEEEVAVQQ-- 347
            :|.|:....|......|              |||                        :.:|:  
  Rat   273 RHPWIDGNTALHRDIYP--------------SVS------------------------LQIQKNF 299

  Fly   348 AKQKDQQQDEELANLCGDAELENKELDATKDNLKNFIVRWETHPNSPYVFDVEGNVIAPLSETSY 412
            ||.|.:|.....|.:....:|..        ||.:..||.|.....|         ::|..|.|.
  Rat   300 AKSKWRQAFNAAAVVHHMRKLHM--------NLHSPSVRQEVENRPP---------VSPAPEVSR 347

  Fly   413 PHPRRTHGADSLSSSRVCSPS---------PCDSIS 439
            |   .:|.: |::.:.:..||         ||...|
  Rat   348 P---GSHDS-SITEAPILDPSTPLPALTRLPCSHSS 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 88/255 (35%)
STKc_MLCK 40..289 CDD:271005 88/249 (35%)
Camk1gNP_878262.1 STKc_CaMKI_gamma 19..303 CDD:271068 98/323 (30%)
S_TKc 23..277 CDD:214567 88/255 (35%)
Autoinhibitory domain 277..317 11/77 (14%)
Calmodulin-binding 297..318 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..387 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.