DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Stk17b

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_596883.1 Gene:Stk17b / 170904 RGDID:620457 Length:371 Species:Rattus norvegicus


Alignment Length:393 Identity:129/393 - (32%)
Similarity:202/393 - (51%) Gaps:60/393 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PAFPMRDVTINRNVDAHKHYDVL-GEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRNVER 78
            |..||:....|      ..|.:. .|:|||||..|.:|..|:.|.:.||||  :.||...::...
  Rat    19 PQTPMKTENFN------NFYTLTPKELGRGKFAVVRQCISKSTGQEYAAKF--LKKRRRGQDCRA 75

  Fly    79 EV-------EIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDD--EFVLTERVCRV 134
            |:       |:..|..|  :|.|:..||....:.:|||...|||:|:..:.:  |.|....|.|:
  Rat    76 EILHEIAVLELARSCPH--VINLHEVYETATEIILVLEYAAGGEIFNLCLPELAEMVSENDVIRL 138

  Fly   135 FIRQVCEAMAFIHGNGIVHLDLKPENILV--LTQKGNRIKIIDFGLARKFDPDKRLRVLFGTPEF 197
             |:|:.|.:.::|.|.||||||||:|||:  :...|: |||:|||::||......||.:.||||:
  Rat   139 -IKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGD-IKIVDFGMSRKIGNASELREIMGTPEY 201

  Fly   198 VAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPEC 262
            :|||::|:|.|:..||||::|:|.|:|::..|||:||::.||..|::....|:.:|.|:.:|...
  Rat   202 LAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLA 266

  Fly   263 LDFIAKLLAKDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAASKSRLKSVSPVTAPSESS 327
            .|||..||.|:...|.||..|:.|.||||                       .....:..|.|:|
  Rat   267 TDFIQSLLVKNPEKRPTAESCLSHSWLQQ-----------------------WDFGSLFHPEETS 308

  Fly   328 EDSTETIEDEDDEEEVAVQQAKQKDQQQDEELANLCGDAELENKELDATKDNLKNFIVRWETHPN 392
            |.|        ..::::::.::.|   ..:.....|||.  |:||.....|:|.:...|::....
  Rat   309 ESS--------QTQDLSLRSSEDK---TPKSCNGSCGDR--EDKENIPEDDSLLSKRFRFDDSLP 360

  Fly   393 SPY 395
            ||:
  Rat   361 SPH 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 104/266 (39%)
STKc_MLCK 40..289 CDD:271005 102/259 (39%)
Stk17bNP_596883.1 STKc_DRAK2 24..293 CDD:271100 105/280 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..345 10/49 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.