DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and PNCK

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:NP_001034671.3 Gene:PNCK / 139728 HGNCID:13415 Length:426 Species:Homo sapiens


Alignment Length:279 Identity:90/279 - (32%)
Similarity:147/279 - (52%) Gaps:6/279 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PAFPMRDVTI--NRNVDAHKHYDVLGEVGRGKFGTVYKCRDKANGLQLAAKFVPIPKREDKRN-V 76
            ||..::|:.:  ....|....|::...:|.|.|..|...:::.:...:|.|.:|......|.. |
Human    77 PAIALQDMLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALV 141

  Fly    77 EREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVCE 141
            |.|:.::..:.|..|:.|...:|....:.:.:||:.|||||||:: :....||:.....:.||..
Human   142 ENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIM-ERGSYTEKDASHLVGQVLG 205

  Fly   142 AMAFIHGNGIVHLDLKPENILVLTQ-KGNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVNF 205
            |::::|..||||.||||||:|..|. :.::|.:.||||: |......|....|||.:||||::..
Human   206 AVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLS-KIQAGNMLGTACGTPGYVAPELLEQ 269

  Fly   206 DCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKLL 270
            .......|:|::|||.|:|:.|..||..|:|.|..|.:..|.|:|:...::.||....|||..||
Human   270 KPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLL 334

  Fly   271 AKDLSTRMTAAECMKHKWL 289
            .:|...|.|..:.::|.|:
Human   335 ERDPQKRFTCQQALRHLWI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 85/256 (33%)
STKc_MLCK 40..289 CDD:271005 84/250 (34%)
PNCKNP_001034671.3 STKc_CaMKI_beta 94..370 CDD:271071 86/262 (33%)
S_TKc 98..353 CDD:214567 85/256 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.