DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and LOC101732252

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_004918774.1 Gene:LOC101732252 / 101732252 -ID:- Length:353 Species:Xenopus tropicalis


Alignment Length:378 Identity:127/378 - (33%)
Similarity:197/378 - (52%) Gaps:74/378 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AHKH-----------YDVLG-EVGRGKFGTVYKCRDKANGLQLAAKFVPIPKR---EDKR-NVER 78
            :|.|           |.::| |:|||||..|.||.:.::|.:.||||  :.||   ||.| ::..
 Frog     6 SHTHTPLREEPFLSSYRLVGKELGRGKFAVVRKCVELSSGKEYAAKF--LRKRRKGEDCRSDIIN 68

  Fly    79 EVEIMNSLQ-HHLIIQLYAAYEYQKMMCVVLELIEGGELFDR-VVDDEFVLTERVCRVFIRQVCE 141
            |:.|:...: ...::.|:..||....:.:|:|...|||:|:: |.|.:...||:.....|.|:.:
 Frog    69 EIAILEMARLSPYVVDLHEVYETNSEIVLVMEYAAGGEIFEQCVADQDEAFTEKDVVRLISQILQ 133

  Fly   142 AMAFIHGNGIVHLDLKPENILVLTQK--GNRIKIIDFGLARKFDPDKRLRVLFGTPEFVAPEVVN 204
            .:..:|.:.:|||||||:|||:.:..  |: |:|:||||:|:.|..|.:|.:.||||:|||||::
 Frog   134 GVLHLHRSNVVHLDLKPQNILLTSSSPLGD-IRIVDFGLSRQVDAIKEIREILGTPEYVAPEVLS 197

  Fly   205 FDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECFNGISPECLDFIAKL 269
            ::.||..||||||||:.||:::|:|||:|:...||..|::.....:..|.|.|||...:|||..|
 Frog   198 YEPISTATDMWSVGVLTYVMLTGVSPFLGDTKQETFLNISQVNIQYSQEDFQGISEPAIDFIKSL 262

  Fly   270 LAKDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAASKSRLKSVSPVTAPSESSEDSTETI 334
            |.|:...|:.|.:|:||.||.                ||.....||..:               :
 Frog   263 LVKNPRKRIRADQCLKHPWLN----------------SATESEPLKDTA---------------V 296

  Fly   335 EDEDDEEEVAVQQAKQKDQQQDEELANL------CGDAELENKELDATKDNLK 381
            |.|:.|.||.            ||:..|      |...:||::  |:.:..||
 Frog   297 EKEEREAEVT------------EEIVLLAAYTVHCPCRQLESR--DSLESELK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 105/263 (40%)
STKc_MLCK 40..289 CDD:271005 102/256 (40%)
LOC101732252XP_004918774.1 PKc_like 13..282 CDD:389743 105/271 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.