DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and Mylk4

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_006253936.1 Gene:Mylk4 / 100911165 RGDID:6494757 Length:656 Species:Rattus norvegicus


Alignment Length:295 Identity:145/295 - (49%)
Similarity:204/295 - (69%) Gaps:16/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IYIDDSEPEGVLEPAFPMRDVTINRNVDA-HKHYDVLGEV------GRGKFGTVYKCRDKANGLQ 59
            :.:||     |..||.|..    :|.|.| |...|.|..|      |.|:||.|:||.:||.||:
  Rat   346 VQLDD-----VPAPAAPFD----HRIVMAKHAAVDSLYSVSKSEILGGGRFGQVHKCEEKATGLK 401

  Fly    60 LAAKFVPIPKREDKRNVEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDE 124
            ||||.:.|...:||.:|:.|:.:||.|.|..:||||.|:|.:..:.:|:|.:||||||||::|:.
  Rat   402 LAAKIIKIRGAKDKEDVKNEISVMNQLDHVNLIQLYDAFESKHDIILVMEYVEGGELFDRIIDEN 466

  Fly   125 FVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLR 189
            ..|||....:|::|:||.:.::|...|:||||||||||.:.:...:||||||||||::.|.::|:
  Rat   467 CNLTELDTILFVKQICEGIRYMHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKLK 531

  Fly   190 VLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDEC 254
            |.||||||:||||||:|.:|:.|||||||||.|:|:||||||:|:||.||::|:...::|.|||.
  Rat   532 VNFGTPEFLAPEVVNYDFVSFATDMWSVGVITYMLLSGLSPFLGDNDAETLTNILACRWDLEDEE 596

  Fly   255 FNGISPECLDFIAKLLAKDLSTRMTAAECMKHKWL 289
            |..||.|..:||:|||.|:.|.|::|:|.:||.||
  Rat   597 FQDISEEAKEFISKLLIKEKSWRISASEALKHPWL 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 133/260 (51%)
STKc_MLCK 40..289 CDD:271005 131/254 (52%)
Mylk4XP_006253936.1 STKc_MLCK4 371..631 CDD:271095 133/259 (51%)
S_TKc 380..631 CDD:214567 130/250 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000818
OrthoInspector 1 1.000 - - oto98074
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.