DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqa and mylk3

DIOPT Version :9

Sequence 1:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster
Sequence 2:XP_002931740.3 Gene:mylk3 / 100498243 XenbaseID:XB-GENE-980367 Length:764 Species:Xenopus tropicalis


Alignment Length:321 Identity:154/321 - (47%)
Similarity:213/321 - (66%) Gaps:28/321 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IDDSEPEGVLEPA-FPMRDVTINR-------NVDAHKHYDVLGEVGRGKFGTVYKCRDKANGLQL 60
            |||..|    .|| |..|.|:|.:       :|..|   :|||  |||:||.|:||.:||.||||
 Frog   427 IDDCPP----PPAPFNHRIVSIKQAILSSCYSVSQH---EVLG--GRGRFGQVHKCIEKATGLQL 482

  Fly    61 AAKFVPIPKREDKRNVEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEF 125
            |||.:.:...:|:..|:.|:.:||.|.|..:||||.|:|.:..:.:::|.::|||||||:.|:.:
 Frog   483 AAKIIKVKGAKDRDEVKNEINVMNQLNHVNLIQLYDAFECKNDLTLIMEYLDGGELFDRITDENY 547

  Fly   126 VLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKRLRV 190
            .|||....:|.:|:||.:.::|...|:||||||||||.:.:.||:||||||||||::.|.::|:|
 Frog   548 SLTELDAIMFTKQICEGIYYLHQQYILHLDLKPENILCVNRTGNQIKIIDFGLARRYKPREKLKV 612

  Fly   191 LFGTPEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFEDECF 255
            .||||||:||||||:|.:|:.|||||||||.|:|:||||||:||:|.|||:.:....:|||.|.|
 Frog   613 NFGTPEFLAPEVVNYDFVSFPTDMWSVGVITYMLLSGLSPFLGESDAETMNYIVNCNWDFESESF 677

  Fly   256 NGISPECLDFIAKLLAKDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAASKSRLKS 316
            ..:|.|..|||:|||.|:.|.|::|.:|:||.||...|..|           ...|.||||
 Frog   678 EQVSEEAKDFISKLLIKERSCRLSAGQCLKHDWLVNLPLKA-----------MKYKVRLKS 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 133/254 (52%)
STKc_MLCK 40..289 CDD:271005 130/248 (52%)
mylk3XP_002931740.3 PKc_like 450..711 CDD:419665 135/265 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 289 1.000 Domainoid score I1536
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000818
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2697
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.