DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dap and cdkn1ba

DIOPT Version :9

Sequence 1:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001013286.1 Gene:cdkn1ba / 402862 ZFINID:ZDB-GENE-040812-3 Length:187 Species:Danio rerio


Alignment Length:208 Identity:49/208 - (23%)
Similarity:72/208 - (34%) Gaps:44/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSSPAVSRNLACGRQLNRIK----RDLFGSSKSAEGTANKTPFNSELERHQELATQKWGFDFRAG 79
            :.||.:.|  ...||.:..|    |.|||:....|...:......|:||   .:.:||.:||...
Zfish     8 NGSPTLER--VDPRQADHGKPPVCRSLFGAVDRQEFAKDVREQMREIER---ASAEKWNYDFAEN 67

  Fly    80 CPLAEKSPYIWERVSFQESSFAPEMYTLTRAAHVRPSADASPSDMDILVNERSERENFGSNLVNS 144
            .||| ...|.|:.|...|   .|:.||       ||.....||....:  :.:...::.....:.
Zfish    68 RPLA-PGDYEWQEVDADE---VPDFYT-------RPPRVKRPSSAGTV--DHNGNHDYFLTAPSP 119

  Fly   145 SLESNTDNESCYDSQDESLAMRLSSSSTTSTSSIVLRKRQPKITEFMKERKRLAQAPKKLSPAKR 209
            |.||...|....|:.:.||:......||.....:...||                      |:..
Zfish   120 SPESGAGNSERADAGNRSLSTPRKRPSTEDQDDLRRSKR----------------------PSVH 162

  Fly   210 MRTSSPSSSATSS 222
            ...:.|...||||
Zfish   163 ASEADPCPDATSS 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dapNP_476948.1 CDI 41..83 CDD:280409 12/41 (29%)
cdkn1baNP_001013286.1 CDI 31..76 CDD:280409 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4743
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10265
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.