DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dap and cdkn1ca

DIOPT Version :9

Sequence 1:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001002040.1 Gene:cdkn1ca / 399483 ZFINID:ZDB-GENE-040123-1 Length:212 Species:Danio rerio


Alignment Length:234 Identity:56/234 - (23%)
Similarity:91/234 - (38%) Gaps:79/234 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSSPAVSRNLACGRQLNRIKRDLFGSSKSAEGTANKTPFNSELERH-QELATQ---KWGFDFRAG 79
            |:.|.::|...|        |:|||.....|       .:.|::|. ||::.:   :|.|:|...
Zfish    17 STFPLLTRTKVC--------RNLFGPVDHEE-------LHCEMKRKLQEISERDQSRWNFNFETN 66

  Fly    80 CPLAEKSPYIWERVSFQESSFAPEMY------TLTRAA-HVRPSADASPSDMDILVNE---RSER 134
            .||  ...|.||.:|   ....|..|      ...||| .|..:.||| |.:|..::.   ..|.
Zfish    67 SPL--PGDYEWEAIS---EDTLPFFYKDKVQNKRARAATSVNATGDAS-STVDCGISRSPVAQES 125

  Fly   135 ENFGSNLVNSSLESNTDNESCYDSQDESLAMRLSSSSTTSTSSIVLRKRQ-------------PK 186
            |...|       ..|..|:       |:::..|:|....|:   |||.|:             |:
Zfish   126 EGVPS-------RPNEPNQ-------ENISGALNSKPARSS---VLRNRRKRSLIPESPRNSTPQ 173

  Fly   187 ITEFMKERKRLAQAPK--------------KLSPAKRMR 211
            ||:|..:|||:.::.:              :::|.|.:|
Zfish   174 ITDFFPKRKRVVESKQDERSYLQAGTSTSIEVTPRKTIR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dapNP_476948.1 CDI 41..83 CDD:280409 12/45 (27%)
cdkn1caNP_001002040.1 CDI 30..74 CDD:280409 13/52 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10265
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.