DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dap and cdkn1bb

DIOPT Version :9

Sequence 1:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_997957.1 Gene:cdkn1bb / 368329 ZFINID:ZDB-GENE-030521-13 Length:179 Species:Danio rerio


Alignment Length:214 Identity:50/214 - (23%)
Similarity:79/214 - (36%) Gaps:49/214 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSARVLN--PVMISEFCKMSSSPAVSRNLACGRQLNRIKRDLFGSSKSAEGTANKTPFNSELER 63
            |.:.|:.|  |.:.....::|..|..|   ||        |:|||.....|   .|..|..:|..
Zfish     1 MSNVRLSNGSPTLERMEARLSDQPKPS---AC--------RNLFGPVDHEE---LKKDFQRQLRT 51

  Fly    64 HQELATQKWGFDFRAGCPLAEKSPYIWERVSFQESSFAPEMYTLTRAA-----HVRPSADASPSD 123
            .::.:.:.|.|||....|.|: ..|.||.:..:.   .|..|:.:...     |:..|.:.:.::
Zfish    52 MEDASAEAWNFDFSTHTPRAD-GRYQWEALDIRS---VPGFYSRSERGKGSDIHISSSGNNNDNN 112

  Fly   124 MDI------LVNERSERENFGSNLVNSSLESNTDNESCYDSQDESLAMRLSSSSTTSTSSIVLRK 182
            :|:      .|.|:|..       ...:|.......||.||..:|....:.....|.|      .
Zfish   113 VDVNGNHDCRVTEQSAE-------TPETLREPRKRSSCLDSSCQSKRSHICVDEVTRT------P 164

  Fly   183 RQPKITEFMKERKRLAQAP 201
            |:||     |.||.|:..|
Zfish   165 RKPK-----KPRKPLSPTP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dapNP_476948.1 CDI 41..83 CDD:280409 12/41 (29%)
cdkn1bbNP_997957.1 CDI 31..76 CDD:280409 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4743
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10265
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.