DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dap and Cdkn1c

DIOPT Version :9

Sequence 1:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001028929.1 Gene:Cdkn1c / 246060 RGDID:727892 Length:355 Species:Rattus norvegicus


Alignment Length:358 Identity:58/358 - (16%)
Similarity:91/358 - (25%) Gaps:181/358 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KMSSS---PAVSRNLACGRQLNRIKRDLFGSSKSAEGTANKTPFNSELE-RHQELATQ---KWGF 74
            :::||   |.::|:.||        |.|||.....|       ...||. |..||..:   :|.|
  Rat    16 RLASSDTFPVIARSSAC--------RSLFGPVDHEE-------LGRELRMRLAELNAEDQNRWDF 65

  Fly    75 DFRAGCPLAEKSPYIWERVSFQESSFAPEMYT--------------------------------- 106
            :|:...||.......|..|   :|...|..|.                                 
  Rat    66 NFQQDVPLRGPGRLQWMEV---DSESVPAFYRETVQVGRCRLQLGPRPPPVAVAVIPRSGPPAGE 127

  Fly   107 ----LTRAAHVRPSADAS----------------------------------------------- 120
                |..|....|||.||                                               
  Rat   128 GPDGLEEAPEQPPSAPASAVVAEPTPPATPAPASDLTSDPIPDVTPVATSDSTPDPIPDVATQDG 192

  Fly   121 ----PSDMDILVNERSER----------------------------------ENFGSNLVNSSLE 147
                |..:...|:|:.|.                                  |..|:..|....|
  Rat   193 EEQVPEQVSEQVSEQGEESGAEPGDELGAEPVSEQGKQQGAEPVEEKDEEPVEEQGAEPVEEKDE 257

  Fly   148 SNTD--NESCYDSQDESLAMR-----------LSSSSTTSTSSIVLRKRQPKITEFMKERKRLAQ 199
            ...:  |....:.|||:..::           .:.::..:.:..:.:...|.|::|..:|||.||
  Rat   258 EPVEGQNGELVEEQDENQELKDQPLSGIPGRPAAGTAAANANGAIKKLSGPLISDFFAKRKRTAQ 322

  Fly   200 APK---------------------KLSPAKRMR 211
            ..|                     :.:|.||:|
  Rat   323 ENKASNDVPAGCPSPNVAPGVGAVEQTPRKRLR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dapNP_476948.1 CDI 41..83 CDD:280409 13/45 (29%)
Cdkn1cNP_001028929.1 CDI 34..80 CDD:280409 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10265
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.