DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dap and Cdkn1b

DIOPT Version :9

Sequence 1:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_034005.2 Gene:Cdkn1b / 12576 MGIID:104565 Length:197 Species:Mus musculus


Alignment Length:235 Identity:57/235 - (24%)
Similarity:92/235 - (39%) Gaps:61/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSARVLNPVMISEFCKMSSSPAVSRNLACGRQLNRIK----RDLFGSSKSAEGTANKTPFNSEL 61
            |.:.||.|           .||::.|..|  ||....|    |:||       |..|......:|
Mouse     1 MSNVRVSN-----------GSPSLERMDA--RQAEHPKPSACRNLF-------GPVNHEELTRDL 45

  Fly    62 ERH----QELATQKWGFDFRAGCPLAEKSPYIWERVSFQESSFAPEMYTLTRAAHVRP------- 115
            |:|    :|.:.:||.|||:...||  :..|.|:.|   |....||.|       .||       
Mouse    46 EKHCRDMEEASQRKWNFDFQNHKPL--EGRYEWQEV---ERGSLPEFY-------YRPPRPPKSA 98

  Fly   116 -------SADASPSDMDI-LVNERSERENFGSNLVNSSLESNTDNESCYDSQDESLAMRLSSSST 172
                   |.|.|.|...: |:..::..|:  .:||: .:..::||.:....|...:..|.::..:
Mouse    99 CKVLAQESQDVSGSRQAVPLIGSQANSED--RHLVD-QMPDSSDNPAGLAEQCPGMRKRPAAEDS 160

  Fly   173 TSTSSIVLRKRQPKITEFMKERKRLAQAPKKLSPAKRMRT 212
            :|.:....|..: .:::.......:.|.|||  |..|.:|
Mouse   161 SSQNKRANRTEE-NVSDGSPNAGTVEQTPKK--PGLRRQT 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dapNP_476948.1 CDI 41..83 CDD:280409 14/45 (31%)
Cdkn1bNP_034005.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 14/52 (27%)
CDI 31..75 CDD:308056 15/52 (29%)
Interaction with CDK2. /evidence=ECO:0000250|UniProtKB:P46527 51..91 15/51 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..197 24/123 (20%)
Nuclear localization signal. /evidence=ECO:0000255 153..169 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4743
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10265
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.