DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dap and Cdkn1a

DIOPT Version :9

Sequence 1:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001104569.1 Gene:Cdkn1a / 12575 MGIID:104556 Length:159 Species:Mus musculus


Alignment Length:194 Identity:46/194 - (23%)
Similarity:72/194 - (37%) Gaps:56/194 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PAVSRNLACGRQLNRIKRDLFGSSKSAEGTANKTPFNSELERH----------QELATQKWGFDF 76
            |...|:..|        |.|||            |.:||..|.          || |.::|.|||
Mouse     9 PVPHRSKVC--------RCLFG------------PVDSEQLRRDCDALMAGCLQE-ARERWNFDF 52

  Fly    77 RAGCPLAEKSPYIWERVSFQESSFAPEMYTLTRAAHVRP--SADASPSDMDILVNERSERENFGS 139
            ....||  :..::||||   .|...|::| |:..:..|.  ..|..||....|:...:..::...
Mouse    53 VTETPL--EGNFVWERV---RSLGLPKVY-LSPGSRSRDDLGGDKRPSTSSALLQGPAPEDHVAL 111

  Fly   140 NLVNSSLESNTDNESCYDSQDESLAMRLSSSSTTSTSSIVLRKRQPKITEFMKERKRLAQAPKK 203
            :|            ||     ..::.|...|.....:|...::||..:|:|...::||....:|
Mouse   112 SL------------SC-----TLVSERPEDSPGGPGTSQGRKRRQTSLTDFYHSKRRLVFCKRK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dapNP_476948.1 CDI 41..83 CDD:280409 15/51 (29%)
Cdkn1aNP_001104569.1 Required for binding cyclins. /evidence=ECO:0000250 17..24 5/26 (19%)
CDI 19..62 CDD:280409 16/57 (28%)
Required for binding CDKs. /evidence=ECO:0000250 53..58 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..106 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..142 5/23 (22%)
PIP-box K+4 motif 135..159 7/24 (29%)
Interaction with TRIM39. /evidence=ECO:0000250|UniProtKB:P38936 147..159 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4743
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.