DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dap and CDKN1A

DIOPT Version :10

Sequence 1:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001278478.1 Gene:CDKN1A / 1026 HGNCID:1784 Length:198 Species:Homo sapiens


Alignment Length:65 Identity:15/65 - (23%)
Similarity:30/65 - (46%) Gaps:12/65 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 LCG---------LTIILCF--QHEKLMQKSSRTEYSPAAPNVQMVHYSPDDIKSTIKLKSLRDVP 370
            :||         ||...|:  |:|..:.|:...:..|:|.: ::|..|.......:.|.:|:::|
Human    49 ICGGVLLERNWVLTAAHCYVDQYEVWLGKNKLFQEEPSAQH-RLVSKSFPHPGFNMSLLTLKEIP 112

  Fly   371  370
            Human   113  112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dapNP_476948.1 CDI 41..91 CDD:460503
CDKN1ANP_001278478.1 CDI 55..100 CDD:460503 10/45 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.