DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dap and cdkn1d

DIOPT Version :9

Sequence 1:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001268406.1 Gene:cdkn1d / 100151464 ZFINID:ZDB-GENE-110215-1 Length:169 Species:Danio rerio


Alignment Length:165 Identity:38/165 - (23%)
Similarity:71/165 - (43%) Gaps:37/165 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IKRDLFGSSKSAEGTANKTPFNSELER----HQELATQKWGFDFRAGCPLAEKSPYIWERVSFQE 97
            |:|:||       |..:......:.:|    :.|.|.|:|.|||:...|:..:..  ||.:..|:
Zfish    27 IRRNLF-------GPVDHQQLQQDFQRLFCMNVETAKQRWNFDFQRDQPVPGRVE--WEELRCQD 82

  Fly    98 SSFAPEMYTLTRAAHVRPSADASPSDMDILVNERSERENFGSNLVNSSLESNTD-NESCYDSQDE 161
               .|..|   |::.||||          ::.:..:||:|..:...::.|...: ..||...:..
Zfish    83 ---VPAFY---RSSVVRPS----------VMKQMLDRESFARSSAATATEKFLELRRSCGGFRGT 131

  Fly   162 SLAMRLSSSSTTSTSSIVLRKRQPKITEFMKERKR 196
            ....|::       :.:.:::||..||:|.:..||
Zfish   132 KPEKRMA-------AVLGVKRRQANITDFFRVTKR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dapNP_476948.1 CDI 41..83 CDD:280409 12/45 (27%)
cdkn1dNP_001268406.1 CDI 30..74 CDD:280409 12/50 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.