DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dap and cdkn1a

DIOPT Version :9

Sequence 1:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_003200962.1 Gene:cdkn1a / 100151416 ZFINID:ZDB-GENE-070705-7 Length:170 Species:Danio rerio


Alignment Length:195 Identity:47/195 - (24%)
Similarity:74/195 - (37%) Gaps:43/195 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SEFCKMSSSPAVSRNLACGRQLNRIKRDLFGSSKSAEGTANKTPFNSELERHQELATQKWGFDFR 77
            |....|::...:.|:|..|    ..:|.|||   ..:....:..:.:.|.|..|.|:::|.|||.
Zfish    12 SAIVTMAAHKRILRSLGNG----PTRRSLFG---PVDREQLQREYRAALRRDLEDASRRWSFDFA 69

  Fly    78 AGCPLAEKSPYIWERVSFQESSFAPEMYTLTRAA----HVRPSADASPSDMDILVNERSERENFG 138
            :..|| |...:.||.||   ....|.:|   ||.    ..||.....|.                
Zfish    70 SEKPL-EGGDFHWEGVS---GVRVPLLY---RACQEKQQKRPCEAHQPG---------------- 111

  Fly   139 SNLVNSSLESNTDNESCYDSQDESLAMRLSSSSTTSTSSIVLRKRQPKITEFMKERKRLAQAPKK 203
                    :|....|:...:.:...|:......|...|| .|:::|..||:|.:.:|||...|:|
Zfish   112 --------QSAAGKENIPKTPERCAALPHEVEKTPEKSS-ELKRKQTNITDFYQAKKRLVATPRK 167

  Fly   204  203
            Zfish   168  167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dapNP_476948.1 CDI 41..83 CDD:280409 12/41 (29%)
cdkn1aXP_003200962.1 CDI 35..76 CDD:280409 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4743
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595421at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.