DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dap and cdkn1cb

DIOPT Version :9

Sequence 1:NP_476948.1 Gene:dap / 36001 FlyBaseID:FBgn0010316 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_001337196.1 Gene:cdkn1cb / 100004175 ZFINID:ZDB-GENE-131127-286 Length:172 Species:Danio rerio


Alignment Length:181 Identity:40/181 - (22%)
Similarity:62/181 - (34%) Gaps:49/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SPAVSRNLACGRQLNRIKRDLFGSSKSAEGTANKTPFNSELERHQELATQKWGFDFRAGCPLA-- 83
            :|.:.|...|        |:|||.....|   .:....|:|....|...|:|.|:|..|.||.  
Zfish    25 APLLKRTGTC--------RNLFGPVDHDE---LRRELASKLREISERDQQRWNFNFSEGQPLDGD 78

  Fly    84 ---EKSPYIWERVSFQESSFAPEMYTLTRAAHVRPSADASPSDMDILVNERSERENFGSNLVNSS 145
               |:||          :...|..|..|     .|........:|:...:|:         :|..
Zfish    79 LKWEESP----------AEGCPLFYRET-----APITMKKRQIVDLPTTQRT---------INVD 119

  Fly   146 LESNTDNESCYDSQDESLAMRLSSSSTTSTSSIVLRKRQPKITEFMKERKR 196
            .:..:..:.|     :|...|..|.....|.|    :...:||:|..:|||
Zfish   120 RKCESPMKFC-----KSQTQRRKSRKRVQTKS----QTNMRITDFYGKRKR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dapNP_476948.1 CDI 41..83 CDD:280409 13/41 (32%)
cdkn1cbXP_001337196.1 CDI 36..80 CDD:280409 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10265
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.