DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG34436

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:118/270 - (43%) Gaps:45/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAA 104
            ||..|:|..:|.|             ....:.|:||||.:.:...    .|.|:|:.:.||:|:|
  Fly    21 QLLDQNCAEVSRL-------------SNDIIFSRPWMALVLLPNK----TCSGALIHKYFVITSA 68

  Fly   105 HCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIAL 169
            .|  :..:.:.| |.||:|.|..         :.:.:...:::.:....:|..:......:||||
  Fly    69 SC--VFNQERAI-VRLGQLSIKQ---------EHIVSYSSDDYHVQSAYIHRFYEKSNFEHDIAL 121

  Fly   170 IKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRF-ANSTMEV-HINTEKCT 232
            ::|...|::|.|||||||.|  :......|:.:.|....||..|.... |..|.:: ||:..||.
  Fly   122 LELQNDVLYKAHIRPICLWL--DKSDIDTQMFKRYETFRWGIDEKYILPAAKTSKIKHISQVKCE 184

  Fly   233 DG----RDTSFLCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTG-SQNCGAGQKAYYM 292
            :.    ...|.:||.......|. ::|.||..|...:.|.|...||:.|.| |:.|      .|.
  Fly   185 NAFKLYPQNSHICAGYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC------LYT 242

  Fly   293 DVPTYVPWIL 302
            ||..|:.||:
  Fly   243 DVTKYIDWIM 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 66/246 (27%)
Tryp_SPc 62..301 CDD:238113 66/245 (27%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 67/236 (28%)
Tryp_SPc 40..251 CDD:214473 66/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.