DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG34437

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:235 Identity:61/235 - (25%)
Similarity:104/235 - (44%) Gaps:38/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PWMAFLHISGDIEMCRCGGSLLSELFVLTAAHC-FKMCPRSKEIRVWLGELDISSTSDCVTYNYQ 137
            |||||  |:...:  .|.|:|:::.:|:|.|.| |.    ..|..|:||..      |.:..|..
  Fly    41 PWMAF--IASPTK--NCSGTLINKQYVITTASCVFD----QSESTVFLGRF------DNIPQNRN 91

  Fly   138 RVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQ 202
            |..     :.::.....|:.:|.....:||||:.|:..|.||..|:|||:.|.:......|:..:
  Fly    92 RYV-----KHSVQSVYTHKLYNKQTFEHDIALLLLDDPVTFKMSIQPICIWLGEITNLNHLESNR 151

  Fly   203 SYMAVGWGRTESRRFAN-STMEVHINTEKCTDG----RDTSFLCANGDYVDTCTGDSGGPLIWKT 262
                  ||.:|...|.. :|::: :..:||.|.    ...|.:||.....:.|| ::|..|:.:.
  Fly   152 ------WGLSEKMIFQRINTVKI-LKIKKCRDSFGITLKKSQICAGFQNGNICT-ETGSSLVKQI 208

  Fly   263 TLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWIL 302
            ...||......|:     |:.|..::..|..:..|:.||:
  Fly   209 HYSGKLWNTLIGI-----QSYGVSERCIYNKIAHYIDWIV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 59/232 (25%)
Tryp_SPc 62..301 CDD:238113 59/232 (25%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 59/232 (25%)
Tryp_SPc 39..242 CDD:304450 59/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455935
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.