DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and tmprss5

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:284 Identity:83/284 - (29%)
Similarity:120/284 - (42%) Gaps:68/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFL-----HISGDIEMCRCGGSLLSELFVLTAA 104
            :||..:.|       .||.||.:::|...||...|     ||        ||||:::..:::|||
Zfish   302 ECGTRAKL-------PRIIGGVEAALGRWPWQVSLYYNNRHI--------CGGSIITNQWIVTAA 351

  Fly   105 HCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIAL 169
            ||.... |..::..|:....|.:::......||        .|.:::.|.::.:|......||||
Zfish   352 HCVHNY-RLPQVPSWVVYAGIITSNLAKLAQYQ--------GFAVERIIYNKNYNHRTHDNDIAL 407

  Fly   170 IKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRT--------ESRRFANSTMEVHI 226
            :||...:.|.|.|||:|||..|.    .|..|......|||.|        |..:.|...:   |
Zfish   408 VKLKTPLNFSDTIRPVCLPQYDH----DLPGGTQCWISGWGYTQPDDVLIPEVLKEAPVPL---I 465

  Fly   227 NTEKCT-----DGRDTS-FLCA--NGDYVDTCTGDSGGPL------IWKTTLFGKARTVQFGVVS 277
            :|:||.     :|..|| .|||  :...||.|.|||||||      :|:..          ||||
Zfish   466 STKKCNSSCMYNGEITSRMLCAGYSEGKVDACQGDSGGPLVCQDENVWRLV----------GVVS 520

  Fly   278 TGSQNCGAGQKAYYMDVPTYVPWI 301
            .|:..........|..|..::.||
Zfish   521 WGTGCAEPNHPGVYSKVAEFLGWI 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 78/266 (29%)
Tryp_SPc 62..301 CDD:238113 77/265 (29%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 2/3 (67%)
Tryp_SPc 311..544 CDD:214473 78/266 (29%)
Tryp_SPc 312..547 CDD:238113 79/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.