DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and prss56

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_017207703.2 Gene:prss56 / 563528 ZFINID:ZDB-GENE-070912-579 Length:849 Species:Danio rerio


Alignment Length:288 Identity:84/288 - (29%)
Similarity:129/288 - (44%) Gaps:52/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EQLTQQDCG----VLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELF 99
            :...|..||    |..|   ..:.|.||.||..:.|.|.||:..|.:.|.:   .|||.|:...:
Zfish   167 QSTAQAVCGQRFSVTQN---GTQPRARIIGGSPAPLGSWPWLVNLRLDGAL---MCGGVLVDSSW 225

  Fly   100 VLTAAHCFKMCPRSKEIRVW---LGELDISSTSDCVTYNYQRVCALPVEE--FTIDKWILHEEFN 159
            ||||||||   ..|:....|   :||.|::.|.              .:|  ..:::.|.|.:||
Zfish   226 VLTAAHCF---AGSRSESYWTAVVGEFDLTKTD--------------ADEQIMKVNRIITHPKFN 273

  Fly   160 LFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRT-ESRRFANSTME 223
            ......||||::|:..|:..:.:.|:|||...:..|     |...:..|||.. |....|:..||
Zfish   274 PKTFNNDIALVELSSPVILSERVTPVCLPSDLDPPA-----GTPCLVAGWGSLYEDGPSADVVME 333

  Fly   224 VHI---NTEKCTD--GRD---TSFLCAN--GDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVST 278
            ..:   :...|..  |::   .:..||.  ...:|:|.||||||||::..|.|:.:.:  |:.|.
Zfish   334 AKVPLLSQATCQSALGKELLTNTMFCAGYLSGGIDSCQGDSGGPLIFQDRLSGRFQLL--GITSW 396

  Fly   279 GSQNCG-AGQKAYYMDVPTYVPWILAKM 305
            | ..|| .|:...|..|..:..|:|.::
Zfish   397 G-DGCGEKGKPGVYTRVTAFSDWVLTEI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 76/256 (30%)
Tryp_SPc 62..301 CDD:238113 75/255 (29%)
prss56XP_017207703.2 Tryp_SPc 191..419 CDD:238113 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.