DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG5909

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:271 Identity:93/271 - (34%)
Similarity:135/271 - (49%) Gaps:29/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHIS-GDIEMCRCGGSLLSELFVLTAAHCFK 108
            :||...|        .:::||:.:.....||:|.|... .|....||||||:||..:||||||  
  Fly   121 NCGNKGN--------PKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHC-- 175

  Fly   109 MCPRSKEIRVWLGELDISSTSDCVTYNY----QRVCALPVEEFTIDKWILHEEFNLFYPGYDIAL 169
            :..:.:.|.|.|||.|:.|..||   :|    .|||..|.||:.|::..:|..:......:|:|:
  Fly   176 IIDQPEVIAVRLGEHDLESEEDC---HYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAI 237

  Fly   170 IKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVHINTEKCTDG 234
            |||::.|..|.||:|:|||:..:  :..|...||:...|||.||....|....:..|..:...:.
  Fly   238 IKLDRVVKEKSHIKPVCLPIDQK--SQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNEC 300

  Fly   235 R--------DTSFLCANGDYV-DTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAY 290
            |        ..:.:||.|..: .||.||||||:.:|.......|.||:||||.|.:.||..|...
  Fly   301 RQYYNKGEVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQPGV 365

  Fly   291 YMDVPTYVPWI 301
            :..|...:|||
  Fly   366 FASVIDMLPWI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 88/253 (35%)
Tryp_SPc 62..301 CDD:238113 88/252 (35%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 88/253 (35%)
Tryp_SPc 132..379 CDD:238113 90/252 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014334
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.810

Return to query results.
Submit another query.