DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and grass

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:276 Identity:102/276 - (36%)
Similarity:146/276 - (52%) Gaps:26/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHIS--GDIEMCRCGGSLLSELFVLTAAHCF 107
            |||        ..|.:|::.|.:..|.|:||||.|...  |:.... |||:::||.::||||||.
  Fly   110 DCG--------NFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFL-CGGAMISERYILTAAHCV 165

  Fly   108 KMCPRS-KEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIK 171
            ...... .|||  |||..||:..||.....::.||.||....|:|.::||:::..:..:||||:|
  Fly   166 HGLQNDLYEIR--LGEHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLK 228

  Fly   172 LNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVHINTE---KCTD 233
            ||:.|.|:.||:|||||:||||.....|: .:|...|||.||:...::..::.::..:   .|:.
  Fly   229 LNRSVPFQKHIKPICLPITDELKEKAEQI-STYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQ 292

  Fly   234 GR----DTSFLC-ANGDYVDTCTGDSGGPLIWKTTLFGK--ARTVQFGVVSTGSQNCG-AGQKAY 290
            ..    ..|.|| ..||..|:|.|||||||.......|:  .:.|:||:||.|...|| ......
  Fly   293 AYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGL 357

  Fly   291 YMDVPTYVPWILAKMA 306
            |.:|..||.||...||
  Fly   358 YTNVGEYVQWITDTMA 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 94/253 (37%)
Tryp_SPc 62..301 CDD:238113 93/252 (37%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 95/253 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014334
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.