DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG9616

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_650347.2 Gene:CG9616 / 41731 FlyBaseID:FBgn0038214 Length:155 Species:Drosophila melanogaster


Alignment Length:129 Identity:27/129 - (20%)
Similarity:48/129 - (37%) Gaps:42/129 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CGGSLLSELFVLTAAH-C---FKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTID 150
            |.|..|.   :|...| |   |:...:.|: :.::|  ..|:..:.:..|            |:.
  Fly    12 CAGPTLG---LLVPQHYCDEHFRYAMKDKQ-QTYIG--IFSAPDEAINSN------------TVL 58

  Fly   151 KWILHEEF----NLF------YPGYDIALIKLNKKV---VFKDHI-------RPICLPLTDELL 194
            .|:...|.    :||      ||..:.|.|.:.:.:   ||.:.:       :...|.|.|:||
  Fly    59 NWLATFEMQGKRDLFVGSMNTYPNKNEAAINIVRGMPAEVFVEFLNITNALPKLTSLYLNDQLL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 27/129 (21%)
Tryp_SPc 62..301 CDD:238113 27/129 (21%)
CG9616NP_650347.2 GD_N 24..128 CDD:292649 23/114 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456007
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.