DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG11670

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:256 Identity:75/256 - (29%)
Similarity:115/256 - (44%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PWMA---FLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYN 135
            |.||   |.:.:.:|:. :|||||:||.||||||||......|.:| |.:|::.:......|...
  Fly   182 PHMAALGFRNENHEIDY-KCGGSLISEEFVLTAAHCLTTHGTSPDI-VKIGDIKLKEWELNVAPQ 244

  Fly   136 YQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICL-PLTDELLAFTLQ 199
            .:||..:          .||..:|.....:||.||:||:.|.:...:||:.| |:.|      :.
  Fly   245 RRRVAQI----------YLHPLYNASLNYHDIGLIQLNRPVEYTWFVRPVRLWPMND------IP 293

  Fly   200 LGQ----SYMAVGWGRTESRRFANSTMEVHINTEKCTD----------GRDTSFLCANGDYV--- 247
            .|:    .|.:.|:.:.::.......:.| :..|:|..          |..||.:||: ||.   
  Fly   294 YGKLHTMGYGSTGFAQPQTNILTELDLSV-VPIEQCNSSLPADEGSPHGLLTSQICAH-DYEKNR 356

  Fly   248 DTCTGDSGGPLIWKTTLFGKARTVQ-------FGVVSTGSQNCGAGQKAYYMDVPTYVPWI 301
            |||.|||||||........:..|.:       .|:.|.|:. |.:.....|..|.:|:.||
  Fly   357 DTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLVGITSYGAY-CRSELPGVYTRVSSYIDWI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 73/254 (29%)
Tryp_SPc 62..301 CDD:238113 73/254 (29%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.