DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG11668

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:365 Identity:85/365 - (23%)
Similarity:140/365 - (38%) Gaps:123/365 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILCLSCPPSSQAGREDWTPH--ELLAYEQL--TQQDCGVLSNLIP----AQRLRRR--------- 61
            :||    |||...:....||  .||....:  ::|.|   :|..|    .:|.|||         
  Fly    74 LLC----PSSWPNQLVCCPHGGYLLPPPSISKSEQAC---ANAYPRAHHKRRRRRRNTNPKLDQV 131

  Fly    62 ----------------ITGGRKSSLLSQPWMA----------FLHISGDIE---MCRCGGSLLSE 97
                            :.|||.:.....|:|.          ::|..|..:   ...||.::::.
  Fly   132 ELVEPIIQKHNQSQNLLVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAP 196

  Fly    98 LFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFY 162
            .|.:|||||..:...|..:.: :|.::::|...              :...|.:...|..|:...
  Fly   197 RFAITAAHCASVGGESPSVAL-IGGVELNSGRG--------------QLIEIKRISQHPHFDAET 246

  Fly   163 PGYDIALIKLNKKVVFKDHIRPICL---------PLTDELLAFTLQLGQSYMAVGWGRTESRRFA 218
            ...|:|::||.:    :.|:...||         |||               |:|:|:|   :||
  Fly   247 LTNDLAVVKLAR----RSHMPVACLWNQESLPERPLT---------------ALGYGQT---KFA 289

  Fly   219 N-------STMEVHINTEKC----------TDGRDTSFLCANGDY---VDTCTGDSGGPLIWKTT 263
            .       ..|..|:|.::|          .:|..:..:|| |||   :|||.|||||||:....
  Fly   290 GPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCA-GDYSGNMDTCQGDSGGPLLLHQH 353

  Fly   264 LFGKARTVQF--GVVSTGSQNCGAGQKAYYMDVPTYVPWI 301
            :.....|:.:  |:.|.|.. |.:||...|:.:..|:.||
  Fly   354 MRHHRHTIPYVVGITSFGGA-CASGQPGVYVRIAHYIQWI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 67/308 (22%)
Tryp_SPc 62..301 CDD:238113 66/282 (23%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 68/283 (24%)
Tryp_SPc 149..392 CDD:214473 66/281 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456056
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.