DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG10041

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:241 Identity:62/241 - (25%)
Similarity:94/241 - (39%) Gaps:59/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWIL 154
            |.|.:||..|||:||||.:..| :|::.|..|...::|......:..:|            :|  
  Fly    68 CVGVILSNEFVLSAAHCIQTNP-TKQLYVAGGADSLNSRKQTRFFVVER------------RW-- 117

  Fly   155 HEEFNLFYPGYDIALIKLNKKVVFKD-HIRPICL---PLTDELLAFTLQLGQSYMAVGWGRT--- 212
            |.:|.:. .|.|||::::..|....| ..|.|..   |..|.        |.....|||||.   
  Fly   118 HPQFRVL-GGNDIAVLRIYPKFPLDDVRFRSINFAGKPQRDS--------GTQASLVGWGRVGVG 173

  Fly   213 ESRRFANS---TMEVHINTEKCTDGRDTSFL-----CA------NGDYVDTCTGDSGGPLIWKTT 263
            :.|:....   |||    .::|.......||     ||      .|    .|.||||.||:    
  Fly   174 KIRKLQEMPFLTME----NDECQQSHRFVFLKPLDICAMHLKGPRG----PCDGDSGAPLM---- 226

  Fly   264 LFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWILAKMAELS 309
              ..|:...:|::|.|.:.|...:...:..:..|..||...|..::
  Fly   227 --NVAKEKLYGLLSYGRKACTPLKPYAFTRINAYSSWIQESMDSMA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 59/231 (26%)
Tryp_SPc 62..301 CDD:238113 59/231 (26%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 61/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456122
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.