DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG16749

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:261 Identity:81/261 - (31%)
Similarity:117/261 - (44%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDI 125
            |:..|..||:...|::  :.:.|......||||::|:.||:|||||                .|.
  Fly    29 RVVNGTDSSVEKYPFV--ISMRGSSGSHSCGGSIISKQFVMTAAHC----------------TDG 75

  Fly   126 SSTSD-CVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGY--DIALIKLNKKVVFKD-HIRPIC 186
            ...|| .|.|...::.|.......:.|.|.||::|. |..|  ||:|:.:.:...|.. .:.|:.
  Fly    76 RKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNP-YNNYANDISLLLVEEPFEFDGVTVAPVK 139

  Fly   187 LPLTDELLAFTLQ--LGQSYMAVGWGRTESRRFANSTM-EVHI---NTEKCTD---GR-DTSFLC 241
            ||   ||...|.|  .|...:.:|||...:..:..||: ||.:   :.|:||:   || |..:..
  Fly   140 LP---ELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHI 201

  Fly   242 ANGDYVD-----TCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCG-AGQKAYYMDVPTYVPW 300
            ..|  ||     .|:||||||||:.    |:    |.|:||...:.|. |.....|..|..||.|
  Fly   202 CGG--VDEGGKGQCSGDSGGPLIYN----GQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256

  Fly   301 I 301
            |
  Fly   257 I 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 79/259 (31%)
Tryp_SPc 62..301 CDD:238113 78/258 (30%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 79/259 (31%)
Tryp_SPc 30..259 CDD:238113 80/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.