DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and MP1

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:371 Identity:112/371 - (30%)
Similarity:162/371 - (43%) Gaps:98/371 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PSSQAG-----REDWTPHELLAYEQLTQQD--------CG-----VL------------------ 49
            |...:|     ||.....|||..|::|:||        ||     ||                  
  Fly    32 PDENSGTCINLRECGYLFELLQSEEVTEQDRRFLQASQCGYRNGQVLEKHFCFTNVQICCANSRM 96

  Fly    50 ------------------------SNLIP-----AQRLRRRITGGRKSSLLSQPWMAFLHIS--G 83
                                    :.|:|     .:....|:.||.:::....||||.:..:  |
  Fly    97 RNQQPQWGNHPQPTQTTKPTKRSGTKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPG 161

  Fly    84 DIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIR-VWLGELDISSTSDC-VTYNYQRVCALPVEE 146
            :::...|||||::..:|||||||....|...|:. |.|||.|.|:..|| |..|.:|.|..|..:
  Fly   162 NVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVD 226

  Fly   147 FTIDKWILHEEFNLFYPG------YDIALIKLNKKVVFKDHIRPICLPLTDELLAF---TLQLGQ 202
            :.:::.|.|.:    |||      .||||::|..:|.:.|.|.|:|||    .||.   .:.||:
  Fly   227 YPVEERIPHPQ----YPGNSRDQLNDIALLRLRDEVQYSDFILPVCLP----TLASQHNNIFLGR 283

  Fly   203 SYMAVGWGRTESRRFANSTMEVHIN---TEKC-----TDGR--DTSFLCANG-DYVDTCTGDSGG 256
            ..:..||||||:...:|..::..::   |.:|     |..|  .|..:||.| :.||:|.|||||
  Fly   284 KVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGG 348

  Fly   257 PLIWKTTLFGKARTVQFGVVSTGSQNCG-AGQKAYYMDVPTYVPWI 301
            ||:.:....|.:.....||||.|...|| .|....|..|..|:.||
  Fly   349 PLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 93/264 (35%)
Tryp_SPc 62..301 CDD:238113 92/263 (35%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855 15/58 (26%)
Tryp_SPc 137..394 CDD:214473 93/264 (35%)
Tryp_SPc 138..397 CDD:238113 94/265 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7585
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.