DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG14642

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:120/260 - (46%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PWMA---FLHISGDIEMCRCGGSLLSELFVLTAAHC---FKMCPRSKEIRVW--LGELDISSTSD 130
            |.||   |....|.::. :|||||:||.||||||||   ::..|:      |  :|:||::|   
  Fly   156 PHMAAVGFESDRGQVDY-KCGGSLISERFVLTAAHCTSIYEAPPK------WVRIGDLDLAS--- 210

  Fly   131 CVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGY-------DIALIKLNKKVVFKDHIRPICLP 188
                          |:.:::..:|..|....:|.|       ||||:||.|:|...:::||:.|.
  Fly   211 --------------EKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLW 261

  Fly   189 LTDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVHINTE---------KCTDGRDTSFLCANG 244
            :..| |..|:.....|.|..:.:..:.|..|..:.|..|.|         :...|...|.:||. 
  Fly   262 VFPE-LPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQ- 324

  Fly   245 DYV---DTCTGDSGGPLIWKTTLFGKARTVQ-----FGVVSTGSQNCGAGQKAYYMDVPTYVPWI 301
            ||:   |||.|||||||  :..|.|:.|..:     .|:.|.| ..|.:...:.|..|.:::.||
  Fly   325 DYILNRDTCQGDSGGPL--QLNLPGRRRGHRIHYHLIGITSYG-VFCRSSYPSVYTRVSSFLDWI 386

  Fly   302  301
              Fly   387  386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 77/258 (30%)
Tryp_SPc 62..301 CDD:238113 77/258 (30%)
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 79/260 (30%)
Tryp_SPc 146..386 CDD:214473 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.