DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG9372

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:330 Identity:98/330 - (29%)
Similarity:153/330 - (46%) Gaps:74/330 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IWGI---LC--------LSCPPSSQAGREDWTPHELLAYE--------QLTQQDCGVLSNLIPAQ 56
            :|.:   ||        :.|...|.:.|  ::|..:.:.:        :..|:.||:.|...|  
  Fly   112 VWRLVSQLCIIEKSSIGICCTDQSTSNR--FSPQVVTSADGDEPRIVNKPEQRGCGITSRQFP-- 172

  Fly    57 RLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKE-IRVWL 120
                |:||||.:.....||||.|...| :....|||.|:::..|||||||  :..::|| |.|.|
  Fly   173 ----RLTGGRPAEPDEWPWMAALLQEG-LPFVWCGGVLITDRHVLTAAHC--IYKKNKEDIFVRL 230

  Fly   121 GELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPI 185
            ||           ||...:......:|.|...:||.::|......|||::::::..:|..:|.|:
  Fly   231 GE-----------YNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPV 284

  Fly   186 CLPLTDELLAFTLQLGQSYMAVGWGRTESRRF----ANSTMEVHINTEKCTDGR--------DTS 238
            |:|..:|..:     .::.:..|||   :::|    :|..|||::...|.:|.|        ||:
  Fly   285 CMPPVNEDWS-----DRNAIVTGWG---TQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHVPDTA 341

  Fly   239 FLCA----NGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCG-AGQKAYYMDVPTYV 298
             :||    .|.  |:|.|||||||:   ......|.|..|:||.| ..|| .|:...|..|..|:
  Fly   342 -MCAGFPEGGQ--DSCQGDSGGPLL---VQLPNQRWVTIGIVSWG-VGCGQRGRPGIYTRVDRYL 399

  Fly   299 PWILA 303
            .||||
  Fly   400 DWILA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 82/257 (32%)
Tryp_SPc 62..301 CDD:238113 81/256 (32%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 3/19 (16%)
Tryp_SPc 173..402 CDD:214473 82/257 (32%)
Tryp_SPc 176..402 CDD:238113 80/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.