DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG4998

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:332 Identity:94/332 - (28%)
Similarity:137/332 - (41%) Gaps:77/332 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSPLGITALIWGILCL-----SCPPSSQAGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRR 61
            |.|:..|..|..:.|.     ..|| .|.||                  |||.:......|::..
  Fly   891 NRPVEKTCRINEVCCRRPLRPQAPP-QQFGR------------------CGVRNAAGITGRIKNP 936

  Fly    62 ITGGRKSSLLSQPW-MAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDI 125
            :.....|.....|| :|.|.......:..|||:|:....:::||||.| .....::||.|||.|:
  Fly   937 VYVDGDSEFGEYPWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIK-SQNGFDLRVRLGEWDV 1000

  Fly   126 SSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPG---YDIALIKLNKKVVF--KDHIRPI 185
            :...:...|..:.|.::.:          |.|   :|.|   .|:|::||::.|.|  ..||.|.
  Fly  1001 NHDVEFFPYIERDVVSVHI----------HPE---YYAGTLDNDLAVLKLDQPVDFTKNPHISPA 1052

  Fly   186 CLPLTDELLAFTLQLGQSYMAVGWGRT---ESRRFANSTMEVHI---NTEKC-TDGRDT------ 237
            |||  |:...||   |......|||:.   |..::.|...||.:   :.::| :..|:|      
  Fly  1053 CLP--DKYSDFT---GARCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRNTRLGYSY 1112

  Fly   238 ----SFLCANGDY-VDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQ---KAYYMDV 294
                .|:||.|:. .|.|.||.||||:....  |....|  ||||.|   .|.||   ...|:.|
  Fly  1113 KLNPGFVCAGGEEGKDACKGDGGGPLVCDRN--GAMHVV--GVVSWG---IGCGQVNVPGVYVKV 1170

  Fly   295 PTYVPWI 301
            ..|:|||
  Fly  1171 SAYLPWI 1177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 78/266 (29%)
Tryp_SPc 62..301 CDD:238113 78/265 (29%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 80/262 (31%)
Tryp_SPc 942..1177 CDD:214473 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.