DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG3700

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:354 Identity:100/354 - (28%)
Similarity:141/354 - (39%) Gaps:122/354 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EQLTQQDCGVL-----------------------------SNLIPAQRLR--------------- 59
            ::||..||.|:                             .||.||::.|               
  Fly    31 KELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSA 95

  Fly    60 ----RRITGGRKSSLLSQPWMAFL------HISGDIEMCRCGGSLLSELFVLTAAHCF------- 107
                ..|.||.|:|....|:||.:      ....||.. .||||::...||||||||.       
  Fly    96 CQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINW-DCGGSVVHPKFVLTAAHCLETDESKA 159

  Fly   108 -KMCPR--SKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGY---- 165
             ::.|.  |.:..|.|||||.:||:|...          |::|.:..:::|       |||    
  Fly   160 ERLDPNFDSPKFVVRLGELDYNSTTDDAL----------VQDFRVVNYVVH-------PGYDTED 207

  Fly   166 -------DIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLG---QSYMAVGWGRTESRRFANS 220
                   ||||::|::|..|.||:..:|||...         |   |...|.|||.|.....::.
  Fly   208 EEQGFKNDIALVELDRKAEFNDHVAAVCLPPDS---------GNDVQQVTAAGWGFTADGVKSSH 263

  Fly   221 TMEVHI---NTEKC-------TDGRDTSFLCAN--GDYVDTCTGDSGGPLIWKTTLFGKARTVQF 273
            .::|::   :.|.|       .|.| |.| ||.  ....|||.||||||:..:..|:...:.| .
  Fly   264 LLKVNLQRFSDEVCQKRLRFSIDTR-TQF-CAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQV-I 325

  Fly   274 GVVSTGSQNCGA-GQKAYYMDVPTYVPWI 301
            |:||.|.. ||: |..:.|..|..|..||
  Fly   326 GIVSYGLV-CGSQGLPSVYTKVHLYTDWI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 88/282 (31%)
Tryp_SPc 62..301 CDD:238113 88/281 (31%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 90/283 (32%)
Tryp_SPc 102..353 CDD:214473 88/281 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.