DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG30283

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:276 Identity:81/276 - (29%)
Similarity:134/276 - (48%) Gaps:43/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 QQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCF 107
            :..||.    :|..:.  :|.||..:.:.|.||||.:...|..   .|||:|::..||||:|||.
  Fly    30 EHPCGT----VPISQF--KILGGHNAPVASAPWMAMVMGEGGF---HCGGTLITNRFVLTSAHCI 85

  Fly   108 KMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKL 172
                .:.|::|.||.|:..:.:               ::|.:|...:|.::  ::..:|:||::|
  Fly    86 ----ANGELKVRLGVLEREAEA---------------QKFAVDAMFVHTDY--YFDQHDLALLRL 129

  Fly   173 NKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESR---RFANSTMEVHINTEKCT-- 232
            .|:|.:.|:|.|||| |.|.|:....:....:...|||:||||   |....|...:::..:|.  
  Fly   130 AKRVHYSDNISPICL-LLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQ 193

  Fly   233 ---DGRDTSFLCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDV 294
               ...:.:.:||.....:||.|||||||....|........||||.|.|..:|  .:...:.:|
  Fly   194 YPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADC--SKATVFTNV 256

  Fly   295 PTYVPWIL--AKMAEL 308
            .|::.||:  .:.||:
  Fly   257 MTHLDWIVNTVRRAEI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 74/247 (30%)
Tryp_SPc 62..301 CDD:238113 74/246 (30%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 74/247 (30%)
Tryp_SPc 43..266 CDD:238113 76/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.