DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG10764

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:272 Identity:81/272 - (29%)
Similarity:129/272 - (47%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMC 110
            ||:.:        |.:|:||..::..:..|||.:..|.|.:   |||:::...|||:||||.   
  Fly    30 CGIST--------RPKISGGDDAAEPNSIWMAAIFNSSDFQ---CGGTIIHMRFVLSAAHCL--- 80

  Fly   111 PRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKK 175
            .|..::.|.||..:|:.               |....|:....:|.:|.......||.|::|::.
  Fly    81 VRGYDLYVRLGARNINE---------------PAAVHTVINVFVHHDFIASEYRNDIGLLQLSES 130

  Fly   176 VVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRR--FANSTMEVHINTEKCTDGRDTS 238
            :|:...::|||:.| |..|..:::..:::.|:|||....:.  ...:...:|:...:|.  |..:
  Fly   131 IVYTVRVQPICIFL-DPALKGSVEKLKTFRALGWGNRNGKLSIMLQTIYLLHLKRNECK--RKLN 192

  Fly   239 F------LCANGDYVDTCTGDSGGPLIWKTTLF--GKARTVQFGVVSTGSQNC-GAGQKAYYMDV 294
            |      :||.....|||.|||||||. ...||  .|:..||.|:||.|...| |.|   .|.||
  Fly   193 FNLNSRQICAGTKNGDTCRGDSGGPLS-TNILFPSNKSYEVQLGIVSFGDPECRGVG---VYTDV 253

  Fly   295 PTYVPWILAKMA 306
            .:||.||.:.:|
  Fly   254 TSYVDWISSTIA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 75/250 (30%)
Tryp_SPc 62..301 CDD:238113 75/249 (30%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 75/250 (30%)
Tryp_SPc 38..263 CDD:238113 77/252 (31%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.