DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG4927

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:341 Identity:91/341 - (26%)
Similarity:139/341 - (40%) Gaps:98/341 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILCLSCPPSSQAGREDWTPH-ELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMA 77
            |:|...|.:.|...:.::.: .|..:|    ::|...:.:..:.|....|.||.|::....|:||
  Fly    60 IVCCLLPNNMQPQSQQFSANIGLRRFE----KECRRFNEIRTSCRTTPFIVGGAKAAGREFPFMA 120

  Fly    78 FL--------HISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIR-----------VWLGEL 123
            .|        .|..|     ||..::...||||||||.: ...:||.|           |.||||
  Fly   121 LLGQRGKNSSQIDWD-----CGAIIIHPKFVLTAAHCLE-TSETKEQRLDPNYDGPKYVVRLGEL 179

  Fly   124 DISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGY-----------DIALIKLNKKVV 177
            |.:||:|         .|.| ::|.:..:::|       |.|           |||:::|..:..
  Fly   180 DYNSTTD---------DAQP-QDFRVLNYVVH-------PAYGEDDDTGSRKNDIAVVELEMEAT 227

  Fly   178 FKDHIRPICLPLT--DELLAFTLQLGQSYMAVGWGRTESRRFANSTM------------------ 222
            |.:::.|.||||.  :|.|        ...|.|||.|.....|:|.:                  
  Fly   228 FSEYVAPACLPLDGGNEQL--------QVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLE 284

  Fly   223 -EVHINTEKCTDGRDTSFLCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGA- 285
             ::.:.|:.|...|.||        .|||.||||||:..:..::...:.| .|:.|.|.. ||. 
  Fly   285 HKIDVRTQLCAGSRSTS--------ADTCYGDSGGPVFVQHPIYSCLKQV-IGITSYGLV-CGVQ 339

  Fly   286 GQKAYYMDVPTYVPWI 301
            |..:.|..|..|..||
  Fly   340 GLPSVYTKVHLYTDWI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 81/291 (28%)
Tryp_SPc 62..301 CDD:238113 81/290 (28%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 83/292 (28%)
Tryp_SPc 105..355 CDD:214473 81/290 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456048
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.