DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG30371

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:267 Identity:72/267 - (26%)
Similarity:120/267 - (44%) Gaps:47/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDI 125
            ||..|::::....|.||.|......:...|||::::..::||||||.....|:..|...:|..|:
  Fly   149 RIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAIVGTNDL 213

  Fly   126 SSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYP--GYDIALIKLNKKVVFKDHIRPICLP 188
            .:.|....|          :::.|.:.|.||:: :..|  ..|||::.....:.:...:.|||||
  Fly   214 GNPSSSRYY----------QQYNIQQMIPHEQY-VSDPDVNNDIAVLITASNIQWSRGVGPICLP 267

  Fly   189 LTDELLAFTLQLGQSYMAVGWGRTESRRFANST----MEVHIN---TEKC-TDGRD-----TSFL 240
            .......||..|..   .:|:|..   .||..|    .::::|   .:.| |:..:     |..:
  Fly   268 PVGTSTPFTYDLVD---VIGYGTV---FFAGPTSTSLQKINLNVVTNQDCQTEYNNVATIYTGQM 326

  Fly   241 CA---NGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPT----YV 298
            |.   :|...|:|..|||||:|.:     |:|....|::|.| ::|...|  |.|.|.|    |:
  Fly   327 CTYDYSGTGRDSCQFDSGGPVILR-----KSRQFLVGIISYG-KSCAESQ--YPMGVNTRITSYI 383

  Fly   299 PWILAKM 305
            .||..|:
  Fly   384 SWIRQKI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 69/261 (26%)
Tryp_SPc 62..301 CDD:238113 68/260 (26%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 69/261 (26%)
Tryp_SPc 150..389 CDD:238113 70/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455995
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.