DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG14760

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster


Alignment Length:237 Identity:73/237 - (30%)
Similarity:115/237 - (48%) Gaps:34/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CGGSLLSELFVLTAAHCFKMCPRSK---EIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDK 151
            ||.:::...::|:||||| :.|.:.   ::||.:||.|::|:.:  |:..||        :.:|.
  Fly   304 CGAAIIHHRYLLSAAHCF-LGPETNSAAKLRVVVGEHDLASSFE--TFATQR--------YDLDA 357

  Fly   152 WILHEEFNLF--YPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQL-GQSYMAVGWGRT- 212
            .||||:|:..  .|..|||::|....:|:..|:.|.||||........|.| |...:|.|||.| 
  Fly   358 LILHEDFSQASGQPKNDIAMLKTRMAIVWSQHVGPACLPLQPGEDGQKLPLAGHQVVAAGWGTTS 422

  Fly   213 ----ESRRFANSTMEVHINTEKC------TDGRDTSFLCANGDYVDTCTGDSGGPLIWKTTLFGK 267
                ::.|...:|::| |:..:|      ..|......|......|||..||||.|..:.    .
  Fly   423 YGGPQTHRLLKATLDV-IDGRRCRQALSSAGGLPPHTFCTYTPGRDTCQYDSGGALYERI----N 482

  Fly   268 ARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWILAKMAELS 309
            .|.:..|:||.| |.|.|.|.:....|.:::.||..|..|::
  Fly   483 GRLMAVGIVSFG-QACAAQQPSVNTRVASFIKWIRTKSPEVA 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 69/227 (30%)
Tryp_SPc 62..301 CDD:238113 69/227 (30%)
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 70/228 (31%)
Tryp_SPc 281..515 CDD:214473 69/227 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455999
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.