DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and KLK3

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:263 Identity:72/263 - (27%)
Similarity:114/263 - (43%) Gaps:55/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDI 125
            ||.||.:....||||...:...|   ...|||.|:...:|||||||.    |:|.: :.||...:
Human    24 RIVGGWECEKHSQPWQVLVASRG---RAVCGGVLVHPQWVLTAAHCI----RNKSV-ILLGRHSL 80

  Fly   126 SSTSDC-----VTYNYQRVCALPVEEFTIDKWILHEEFNLFY-PG----YDIALIKLNKKVVFKD 180
            ....|.     |::::..    |:.:.::.|       |.|. ||    :|:.|::|::.....|
Human    81 FHPEDTGQVFQVSHSFPH----PLYDMSLLK-------NRFLRPGDDSSHDLMLLRLSEPAELTD 134

  Fly   181 HIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFAN----STMEVH-INTEKCTD---GRDT 237
            .::.:.||..:.      .||.:..|.|||..|...|..    ..:::| |:.:.|..   .:.|
Human   135 AVKVMDLPTQEP------ALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVT 193

  Fly   238 SFLCANGDYV---DTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQK-AYYMDVPTYV 298
            .|:...|.:.   .||:|||||||:        ...|..|:.|.||:.|...:: :.|..|..|.
Human   194 KFMLCAGRWTGGKSTCSGDSGGPLV--------CNGVLQGITSWGSEPCALPERPSLYTKVVHYR 250

  Fly   299 PWI 301
            .||
Human   251 KWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 70/261 (27%)
Tryp_SPc 62..301 CDD:238113 69/260 (27%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 71/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.