DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and Prss33

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_017173005.1 Gene:Prss33 / 353130 MGIID:2661234 Length:341 Species:Mus musculus


Alignment Length:361 Identity:92/361 - (25%)
Similarity:120/361 - (33%) Gaps:116/361 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILCLSCPPS--------------------SQAGRED---WTPH---ELLAYEQLTQQDCGVLSNL 52
            :|||..|..                    :||..||   ...|   .||.......|:|..... 
Mouse    28 LLCLLSPQDLPWPHQREHQASRTRDQATCTQASSEDTMRGASHLQILLLLVLGTRMQECAACGQ- 91

  Fly    53 IPAQRLRRRITGGRKSSLLSQPWMAFL-HISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEI 116
               .|:..||.|||.:.....||...: |....:    |||||::..:||||.|||   ||    
Mouse    92 ---PRMSSRIVGGRDAQDGEWPWQTSIQHRGAHV----CGGSLIAPQWVLTAGHCF---PR---- 142

  Fly   117 RVWLGE---------LDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGY------- 165
            |||..|         ||:.|:.:.:         :||...            |..|.|       
Mouse   143 RVWPSEYSVLLGALSLDVRSSHELL---------VPVLRV------------LLPPDYSEDEARG 186

  Fly   166 DIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTE----------------- 213
            |:||::|...|.....|:|:|||....    ....|......|||...                 
Mouse   187 DLALLQLRHPVSLSTRIQPVCLPAPGS----HPPPGSPCWVTGWGSLSPGVPLPKGRPLQGVRVP 247

  Fly   214 --SRRFANSTMEVHINTEK----CTDGRDTSFLCA--NGDYVDTCTGDSGGPLIWKTTLFGKART 270
              ..|..:....|..|..:    ...|.    |||  ...:.|.|.|||||||    |.......
Mouse   248 LLDSRACDRLYHVGANVPQGERIVLPGN----LCAGYRRGHKDACQGDSGGPL----TCMESGHW 304

  Fly   271 VQFGVVSTGSQNCGAGQKAYYMDVPTYVPWILAKMA 306
            |..||||.|.......:...|.:|..|.|||.|:::
Mouse   305 VLVGVVSWGKGCALPNRPGVYTNVAKYSPWIQARLS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 75/281 (27%)
Tryp_SPc 62..301 CDD:238113 74/280 (26%)
Prss33XP_017173005.1 Tryp_SPc 98..336 CDD:238113 75/281 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.