DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG18477

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:317 Identity:78/317 - (24%)
Similarity:121/317 - (38%) Gaps:67/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CLS---CPPSSQAGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQ---- 73
            |:|   |.|.:...:|.    .|:..|.:|...||.:::.......|...||      |:|    
  Fly    64 CVSTAICCPKNLIIKEP----RLIINEPITDPQCGFVNSKGVTFSFREEDTG------LAQEAEV 118

  Fly    74 PWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQR 138
            |||..| :.........||:|::...|:||....:....| ::.|..||.|.|:.::        
  Fly   119 PWMVAL-LDARTSSYVAGGALIAPHVVITARQRTENMTAS-QLVVRAGEWDFSTKTE-------- 173

  Fly   139 VCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQS 203
              .||..:..|...:.|..|||.....::||:.|.:.:....||.|||:|...:...|:     .
  Fly   174 --QLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFS-----R 231

  Fly   204 YMAVGWGRTE------------------SRRFANSTMEVHINTEKCTDGRDTSFLCANGD-YVDT 249
            .:..|||:..                  .||.....:.::...:   ...|.|.:||.|: ..|:
  Fly   232 CIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGND---FELDNSLMCAGGEPGKDS 293

  Fly   250 CTGDSGGPLIW----KTTLFGKARTVQFGVVSTGSQNCG-AGQKAYYMDVPTYVPWI 301
            |.||.|.||..    ....:..|..|.|||      :|| .|..|.|.:|...:.||
  Fly   294 CEGDGGSPLACAIKDNPQRYELAGIVNFGV------DCGLPGVPAVYTNVANVIEWI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 65/267 (24%)
Tryp_SPc 62..301 CDD:238113 65/266 (24%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 62/256 (24%)
Tryp_SPc 113..344 CDD:238113 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.