DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG4650

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:316 Identity:81/316 - (25%)
Similarity:130/316 - (41%) Gaps:78/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGITALIWGILCLSCPPSSQ--AGREDWTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGRK 67
            :||:||::   .|..|.|||  .||                  ||:|:|             |:.
  Fly     6 IGISALLF---LLPVPGSSQYLDGR------------------CGLLTN-------------GKI 36

  Fly    68 SSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGE-LDISSTSDC 131
            ::.:|.||||:||.|..:.:  |||::::|..|||||||.:   .|:::...:|| :.....:|.
  Fly    37 ANNISSPWMAYLHTSELLYV--CGGTVITEKLVLTAAHCTR---ASEQLVARIGEFIGTDDANDT 96

  Fly   132 VTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICL-------PL 189
            :...||           :.:..:|..:|......|||::.|...:||...|||||:       ..
  Fly    97 MLSEYQ-----------VSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRKY 150

  Fly   190 TDELLAFTLQLGQSYMAVGWGRTESRRFANSTMEVHINTE---KCTDGRDTSFL----CANGDYV 247
            .|.:        |......||....|..:::.....|..:   .|:....|:.|    ||.....
  Fly   151 IDNI--------QVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQFCAGDSDS 207

  Fly   248 DTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAYYMDVPTYVPWILA 303
            ..|..|...||....|.....|.|..|:.:| :|.|  .:.:.|.||.::..:||:
  Fly   208 KLCNVDFSSPLGAIITFKNIQRYVLIGIATT-NQKC--KRASVYTDVLSHTDFILS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 64/254 (25%)
Tryp_SPc 62..301 CDD:238113 64/253 (25%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 65/264 (25%)
Tryp_SPc 33..258 CDD:304450 65/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.