DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1773 and CG4259

DIOPT Version :9

Sequence 1:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:271 Identity:69/271 - (25%)
Similarity:115/271 - (42%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VLSNLIPAQ-----RLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCG-GSLLSELFVLTAAHC 106
            ::.:|:.:|     ::||...|....:..  ||:..:....|......| |||::...||||||.
  Fly    11 LIISLVNSQYFNYNQIRRETYGSNPRATF--PWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHI 73

  Fly   107 FKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIK 171
            .....: .::.|..||.|.|:|:|     .|.|   .:|...|   :.||:||.|....::||:.
  Fly    74 LNGTTK-YDLVVRAGEWDTSTTAD-----QQHV---DLEVLNI---VSHEQFNRFNAENNMALLI 126

  Fly   172 LNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFANS--------TMEVHINT 228
            |........:|..|.|.|.:.    .:|.|..:.. |||:.    :.||        |::|.:.:
  Fly   127 LVSAFEMTANINLIPLYLQEA----GIQKGSCFFN-GWGKV----YLNSTDYPTVLKTVQVDLLS 182

  Fly   229 EKCTDGRDTSF--LCANG-DYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGAGQKAY 290
            ......|....  :|..| :.:| |:||.|.||:.:...: ..:..|.|:|:..||.........
  Fly   183 MGMCSSRKLPIQQICGKGLEGID-CSGDGGAPLVCRILTY-PYKYAQVGIVNWLSQKPVENTFIV 245

  Fly   291 YMDVPTYVPWI 301
            :.:|...:|||
  Fly   246 FTNVAGLLPWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 63/251 (25%)
Tryp_SPc 62..301 CDD:238113 63/250 (25%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/243 (26%)
Tryp_SPc 39..256 CDD:214473 62/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.